Fibronectin-Binding Protein Peptide,Cas:119977-20-7
Fibronectin-Binding Protein Peptide
Product description
The fibronectin-binding protein A promotes bacterial attachment to multiple substrates, such as fibronectin, fibrinogen, elastin peptides and tropoelastin, confering to Staphylococcus aureus the ability to invade endothelial cells. The peptide also promotes adherence to and aggregation of activated platelets.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 119977-20-7 |
Synonyms | Fibronectin-binding protein A; fnbA |
Sequence | H-Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val-OH or H-FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV-OH |
Molecular Formula | C190H283N49O66 |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product